Placeholder image of a protein
Icon representing a puzzle

1774: Revisiting Puzzle 84: Giant Anemone

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
December 17, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Go Science 100 pts. 9,833
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,793
  3. Avatar for Contenders 3. Contenders 52 pts. 9,785
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,779
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,740
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,738
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 9,708
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,658
  9. Avatar for Russian team 9. Russian team 4 pts. 9,567
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,564

  1. Avatar for johngran 61. johngran Lv 1 3 pts. 8,543
  2. Avatar for Pawel Tluscik 62. Pawel Tluscik Lv 1 3 pts. 8,528
  3. Avatar for hada 63. hada Lv 1 3 pts. 8,517
  4. Avatar for Pisqis 64. Pisqis Lv 1 3 pts. 8,492
  5. Avatar for Hellcat6 65. Hellcat6 Lv 1 2 pts. 8,490
  6. Avatar for micheldeweerd 66. micheldeweerd Lv 1 2 pts. 8,486
  7. Avatar for kevin everington 67. kevin everington Lv 1 2 pts. 8,428
  8. Avatar for rezaefar 68. rezaefar Lv 1 2 pts. 8,419
  9. Avatar for Silvercraft 69. Silvercraft Lv 1 2 pts. 8,381
  10. Avatar for rinze 70. rinze Lv 1 2 pts. 8,379

Comments