Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,386
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,323
  3. Avatar for Russian team 13. Russian team 1 pt. 9,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,129
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,804
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,434
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,229
  8. Avatar for Team New Zealand 18. Team New Zealand 1 pt. 7,998
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,916
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 96 pts. 9,907
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 92 pts. 9,888
  4. Avatar for crpainter 4. crpainter Lv 1 87 pts. 9,827
  5. Avatar for Galaxie 5. Galaxie Lv 1 83 pts. 9,824
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 79 pts. 9,808
  7. Avatar for Phyx 7. Phyx Lv 1 76 pts. 9,804
  8. Avatar for Deleted player 8. Deleted player 72 pts. 9,795
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 69 pts. 9,752
  10. Avatar for TastyMunchies 10. TastyMunchies Lv 1 65 pts. 9,751

Comments