Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,386
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,323
  3. Avatar for Russian team 13. Russian team 1 pt. 9,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,129
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,804
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,434
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,229
  8. Avatar for Team New Zealand 18. Team New Zealand 1 pt. 7,998
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,908
  2. Avatar for Deleted player 2. Deleted player 79 pts. 9,905
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 61 pts. 9,902
  4. Avatar for silent gene 4. silent gene Lv 1 47 pts. 9,885
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 35 pts. 9,882
  6. Avatar for pauldunn 6. pauldunn Lv 1 26 pts. 9,878
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 19 pts. 9,878
  8. Avatar for SiliconDioxide 8. SiliconDioxide Lv 1 14 pts. 9,861
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 10 pts. 9,861
  10. Avatar for Dhalion 10. Dhalion Lv 1 7 pts. 9,829

Comments