Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,916
  2. Avatar for Go Science 2. Go Science 74 pts. 9,907
  3. Avatar for Contenders 3. Contenders 54 pts. 9,827
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,824
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,745
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,734
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,684
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,663
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,509
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 3 pts. 9,393
  1. Avatar for Galaxie 11. Galaxie Lv 1 4 pts. 9,824
  2. Avatar for phi16 12. phi16 Lv 1 3 pts. 9,801
  3. Avatar for robgee 13. robgee Lv 1 2 pts. 9,798
  4. Avatar for Deleted player 14. Deleted player pts. 9,798
  5. Avatar for alwen 15. alwen Lv 1 1 pt. 9,793
  6. Avatar for fpc 16. fpc Lv 1 1 pt. 9,745
  7. Avatar for Anfinsen_slept_here 17. Anfinsen_slept_here Lv 1 1 pt. 9,708
  8. Avatar for knotartist 18. knotartist Lv 1 1 pt. 9,676
  9. Avatar for alcor29 19. alcor29 Lv 1 1 pt. 9,627
  10. Avatar for Blipperman 20. Blipperman Lv 1 1 pt. 9,620

Comments