Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 9,916
  2. Avatar for Go Science 2. Go Science 74 pts. 9,907
  3. Avatar for Contenders 3. Contenders 54 pts. 9,827
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,824
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,745
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,734
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,684
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,663
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,509
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 3 pts. 9,393

  1. Avatar for Crazy Chemist 101. Crazy Chemist Lv 1 1 pt. 7,336
  2. Avatar for gdnskye 102. gdnskye Lv 1 1 pt. 7,310
  3. Avatar for 01010011111 103. 01010011111 Lv 1 1 pt. 7,149
  4. Avatar for halblauterpc 104. halblauterpc Lv 1 1 pt. 6,658
  5. Avatar for xrup 105. xrup Lv 1 1 pt. 5,075
  6. Avatar for katling 106. katling Lv 1 1 pt. 4,986
  7. Avatar for fold_in_fold 107. fold_in_fold Lv 1 1 pt. 4,760
  8. Avatar for multaq 108. multaq Lv 1 1 pt. 4,300
  9. Avatar for lconor 109. lconor Lv 1 1 pt. 4,300

Comments