Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 9,916
  2. Avatar for Go Science 2. Go Science 74 pts. 9,907
  3. Avatar for Contenders 3. Contenders 54 pts. 9,827
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,824
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,745
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,734
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,684
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,663
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,509
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 3 pts. 9,393

  1. Avatar for RockOn 11. RockOn Lv 1 62 pts. 9,746
  2. Avatar for nicobul 12. nicobul Lv 1 59 pts. 9,734
  3. Avatar for johnmitch 13. johnmitch Lv 1 56 pts. 9,700
  4. Avatar for grogar7 14. grogar7 Lv 1 53 pts. 9,685
  5. Avatar for Blipperman 15. Blipperman Lv 1 50 pts. 9,684
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 48 pts. 9,663
  7. Avatar for robgee 17. robgee Lv 1 45 pts. 9,656
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 43 pts. 9,654
  9. Avatar for MicElephant 19. MicElephant Lv 1 41 pts. 9,632
  10. Avatar for phi16 20. phi16 Lv 1 39 pts. 9,618

Comments