Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 9,916
  2. Avatar for Go Science 2. Go Science 74 pts. 9,907
  3. Avatar for Contenders 3. Contenders 54 pts. 9,827
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,824
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,745
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,734
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,684
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,663
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,509
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 3 pts. 9,393

  1. Avatar for aznarog 21. aznarog Lv 1 36 pts. 9,590
  2. Avatar for Enzyme 22. Enzyme Lv 1 34 pts. 9,581
  3. Avatar for frood66 23. frood66 Lv 1 33 pts. 9,575
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 31 pts. 9,566
  5. Avatar for jobo0502 25. jobo0502 Lv 1 29 pts. 9,541
  6. Avatar for silent gene 26. silent gene Lv 1 27 pts. 9,518
  7. Avatar for haabermaaster 27. haabermaaster Lv 1 26 pts. 9,509
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 24 pts. 9,487
  9. Avatar for diamonddays 29. diamonddays Lv 1 23 pts. 9,485
  10. Avatar for Deleted player 30. Deleted player pts. 9,477

Comments