Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 9,916
  2. Avatar for Go Science 2. Go Science 74 pts. 9,907
  3. Avatar for Contenders 3. Contenders 54 pts. 9,827
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,824
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,745
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,734
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,684
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,663
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,509
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 3 pts. 9,393

  1. Avatar for alwen 51. alwen Lv 1 5 pts. 9,183
  2. Avatar for Alistair69 52. Alistair69 Lv 1 5 pts. 9,170
  3. Avatar for fpc 53. fpc Lv 1 4 pts. 9,161
  4. Avatar for kitek314_pl 54. kitek314_pl Lv 1 4 pts. 9,129
  5. Avatar for Dhalion 55. Dhalion Lv 1 4 pts. 9,119
  6. Avatar for Merf 56. Merf Lv 1 3 pts. 9,105
  7. Avatar for WBarme1234 57. WBarme1234 Lv 1 3 pts. 9,098
  8. Avatar for alcor29 58. alcor29 Lv 1 3 pts. 9,050
  9. Avatar for Pawel Tluscik 59. Pawel Tluscik Lv 1 3 pts. 9,044
  10. Avatar for rabamino12358 60. rabamino12358 Lv 1 2 pts. 9,042

Comments