Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 9,916
  2. Avatar for Go Science 2. Go Science 74 pts. 9,907
  3. Avatar for Contenders 3. Contenders 54 pts. 9,827
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,824
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,745
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,734
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,684
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,663
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,509
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 3 pts. 9,393

  1. Avatar for abiogenesis 61. abiogenesis Lv 1 2 pts. 8,997
  2. Avatar for Arne Heessels 62. Arne Heessels Lv 1 2 pts. 8,994
  3. Avatar for Vincera 63. Vincera Lv 1 2 pts. 8,984
  4. Avatar for heather-1 64. heather-1 Lv 1 2 pts. 8,980
  5. Avatar for rezaefar 65. rezaefar Lv 1 2 pts. 8,963
  6. Avatar for manu8170 66. manu8170 Lv 1 2 pts. 8,939
  7. Avatar for roman madala 67. roman madala Lv 1 1 pt. 8,928
  8. Avatar for ChargingFerret 68. ChargingFerret Lv 1 1 pt. 8,913
  9. Avatar for knotartist 69. knotartist Lv 1 1 pt. 8,877
  10. Avatar for kevin everington 70. kevin everington Lv 1 1 pt. 8,868

Comments