Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 10,241
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,051
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,865
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,814
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,349
  6. Avatar for uneRx 16. uneRx 1 pt. 7,460
  7. Avatar for Team New Zealand 17. Team New Zealand 1 pt. 6,469
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 4,094
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 11,104
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 96 pts. 11,079
  3. Avatar for johnmitch 3. johnmitch Lv 1 92 pts. 11,029
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 88 pts. 11,009
  5. Avatar for jobo0502 5. jobo0502 Lv 1 84 pts. 10,975
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 80 pts. 10,955
  7. Avatar for Deleted player 7. Deleted player 76 pts. 10,952
  8. Avatar for crpainter 8. crpainter Lv 1 72 pts. 10,950
  9. Avatar for Timo van der Laan 9. Timo van der Laan Lv 1 69 pts. 10,944
  10. Avatar for LociOiling 10. LociOiling Lv 1 66 pts. 10,922

Comments