Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,104
  2. Avatar for Go Science 2. Go Science 74 pts. 11,079
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,975
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,953
  5. Avatar for Contenders 5. Contenders 27 pts. 10,950
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,944
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,836
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,748
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,617
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 10,314
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,098
  2. Avatar for phi16 2. phi16 Lv 1 78 pts. 11,077
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 60 pts. 11,073
  4. Avatar for ZeroLeak7 4. ZeroLeak7 Lv 1 45 pts. 11,071
  5. Avatar for silent gene 5. silent gene Lv 1 33 pts. 11,067
  6. Avatar for Anfinsen_slept_here 6. Anfinsen_slept_here Lv 1 24 pts. 11,066
  7. Avatar for robgee 7. robgee Lv 1 17 pts. 11,036
  8. Avatar for Deleted player 8. Deleted player pts. 11,030
  9. Avatar for alwen 9. alwen Lv 1 8 pts. 11,027
  10. Avatar for alcor29 10. alcor29 Lv 1 6 pts. 11,023

Comments