Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,104
  2. Avatar for Go Science 2. Go Science 74 pts. 11,079
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,975
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,953
  5. Avatar for Contenders 5. Contenders 27 pts. 10,950
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,944
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,836
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,748
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,617
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 10,314

  1. Avatar for acarlson5 101. acarlson5 Lv 1 1 pt. 7,460
  2. Avatar for NewZealand 102. NewZealand Lv 1 1 pt. 6,469
  3. Avatar for 01010011111 103. 01010011111 Lv 1 1 pt. 5,438
  4. Avatar for bkoep 104. bkoep Lv 1 1 pt. 4,094
  5. Avatar for Bithalbierer 106. Bithalbierer Lv 1 1 pt. 4,094
  6. Avatar for toshiue 107. toshiue Lv 1 1 pt. 4,094
  7. Avatar for drumpeter18yrs9yrs 108. drumpeter18yrs9yrs Lv 1 1 pt. 4,094
  8. Avatar for Museka 109. Museka Lv 1 1 pt. 4,094
  9. Avatar for Sciren 110. Sciren Lv 1 1 pt. 4,094

Comments