Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,104
  2. Avatar for Go Science 2. Go Science 74 pts. 11,079
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,975
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,953
  5. Avatar for Contenders 5. Contenders 27 pts. 10,950
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,944
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,836
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,748
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,617
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 10,314

  1. Avatar for vakobo 41. vakobo Lv 1 11 pts. 10,241
  2. Avatar for joremen 42. joremen Lv 1 10 pts. 10,208
  3. Avatar for pvc78 43. pvc78 Lv 1 10 pts. 10,131
  4. Avatar for georg137 44. georg137 Lv 1 9 pts. 10,114
  5. Avatar for Enzyme 45. Enzyme Lv 1 8 pts. 10,075
  6. Avatar for Idiotboy 46. Idiotboy Lv 1 8 pts. 10,053
  7. Avatar for versat82 47. versat82 Lv 1 7 pts. 10,051
  8. Avatar for fpc 48. fpc Lv 1 7 pts. 10,007
  9. Avatar for WBarme1234 49. WBarme1234 Lv 1 6 pts. 9,953
  10. Avatar for phi16 50. phi16 Lv 1 6 pts. 9,950

Comments