Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,104
  2. Avatar for Go Science 2. Go Science 74 pts. 11,079
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,975
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,953
  5. Avatar for Contenders 5. Contenders 27 pts. 10,950
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,944
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,836
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,748
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,617
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 10,314

  1. Avatar for johngran 51. johngran Lv 1 5 pts. 9,888
  2. Avatar for jausmh 52. jausmh Lv 1 5 pts. 9,842
  3. Avatar for CAN1958 53. CAN1958 Lv 1 5 pts. 9,720
  4. Avatar for SiliconDioxide 54. SiliconDioxide Lv 1 4 pts. 9,706
  5. Avatar for Glen B 55. Glen B Lv 1 4 pts. 9,685
  6. Avatar for Hellcat6 56. Hellcat6 Lv 1 4 pts. 9,682
  7. Avatar for pfirth 57. pfirth Lv 1 3 pts. 9,466
  8. Avatar for alcor29 58. alcor29 Lv 1 3 pts. 9,430
  9. Avatar for abiogenesis 59. abiogenesis Lv 1 3 pts. 9,400
  10. Avatar for t012 60. t012 Lv 1 3 pts. 9,385

Comments