Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 8,635
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,565
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,417
  4. Avatar for :) 14. :) 1 pt. 8,282
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,125
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,785
  7. Avatar for uneRx 17. uneRx 1 pt. 7,521
  8. Avatar for Team China 18. Team China 1 pt. 7,288
  1. Avatar for Kiwegapa 91. Kiwegapa Lv 1 1 pt. 8,118
  2. Avatar for lange 92. lange Lv 1 1 pt. 8,116
  3. Avatar for S0lar 93. S0lar Lv 1 1 pt. 8,097
  4. Avatar for Old Chap 94. Old Chap Lv 1 1 pt. 8,043
  5. Avatar for multaq 95. multaq Lv 1 1 pt. 8,043
  6. Avatar for Tapporauta45 96. Tapporauta45 Lv 1 1 pt. 8,042
  7. Avatar for 01010011111 97. 01010011111 Lv 1 1 pt. 8,007
  8. Avatar for justjustin 98. justjustin Lv 1 1 pt. 7,973
  9. Avatar for Amitron 99. Amitron Lv 1 1 pt. 7,961
  10. Avatar for t012 100. t012 Lv 1 1 pt. 7,908

Comments