Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 8,635
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,565
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,417
  4. Avatar for :) 14. :) 1 pt. 8,282
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,125
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,785
  7. Avatar for uneRx 17. uneRx 1 pt. 7,521
  8. Avatar for Team China 18. Team China 1 pt. 7,288
  1. Avatar for kwsui 111. kwsui Lv 1 1 pt. 7,288
  2. Avatar for drumpeter18yrs9yrs 112. drumpeter18yrs9yrs Lv 1 1 pt. 6,936
  3. Avatar for khystan 113. khystan Lv 1 1 pt. 4,761
  4. Avatar for Killua012 114. Killua012 Lv 1 1 pt. 3,921
  5. Avatar for tamanrasset 115. tamanrasset Lv 1 1 pt. 3,872
  6. Avatar for polymorphicchanges 116. polymorphicchanges Lv 1 1 pt. 3,852
  7. Avatar for CharlieFortsConscience 117. CharlieFortsConscience Lv 1 1 pt. 3,852
  8. Avatar for Babel Ayala 118. Babel Ayala Lv 1 1 pt. 3,852
  9. Avatar for Curvy_meow 119. Curvy_meow Lv 1 1 pt. 3,852
  10. Avatar for bkoep 120. bkoep Lv 1 1 pt. 3,852

Comments