Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 8,635
  2. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,417
  3. Avatar for :) 14. :) 1 pt. 8,282
  4. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,125
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,785
  6. Avatar for uneRx 17. uneRx 1 pt. 7,521
  7. Avatar for Team China 18. Team China 1 pt. 7,288

  1. Avatar for O Seki To 11. O Seki To Lv 1 65 pts. 9,021
  2. Avatar for MicElephant 12. MicElephant Lv 1 62 pts. 9,018
  3. Avatar for johnmitch 13. johnmitch Lv 1 59 pts. 9,013
  4. Avatar for LociOiling 14. LociOiling Lv 1 57 pts. 9,006
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 54 pts. 9,002
  6. Avatar for Enzyme 16. Enzyme Lv 1 51 pts. 9,000
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 49 pts. 8,994
  8. Avatar for georg137 18. georg137 Lv 1 47 pts. 8,986
  9. Avatar for crpainter 19. crpainter Lv 1 45 pts. 8,981
  10. Avatar for silent gene 20. silent gene Lv 1 42 pts. 8,969

Comments