Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 8,635
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,565
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,417
  4. Avatar for :) 14. :) 1 pt. 8,282
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,125
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,785
  7. Avatar for uneRx 17. uneRx 1 pt. 7,521
  8. Avatar for Team China 18. Team China 1 pt. 7,288
  1. Avatar for robgee 21. robgee Lv 1 40 pts. 8,963
  2. Avatar for fiendish_ghoul 22. fiendish_ghoul Lv 1 38 pts. 8,955
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 36 pts. 8,945
  4. Avatar for Skippysk8s 24. Skippysk8s Lv 1 35 pts. 8,945
  5. Avatar for Anfinsen_slept_here 25. Anfinsen_slept_here Lv 1 33 pts. 8,922
  6. Avatar for Threeoak 26. Threeoak Lv 1 31 pts. 8,918
  7. Avatar for Silvercraft 27. Silvercraft Lv 1 30 pts. 8,912
  8. Avatar for nicobul 28. nicobul Lv 1 28 pts. 8,908
  9. Avatar for dcrwheeler 29. dcrwheeler Lv 1 27 pts. 8,908
  10. Avatar for Deleted player 30. Deleted player pts. 8,903

Comments