Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 8,635
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,565
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,417
  4. Avatar for :) 14. :) 1 pt. 8,282
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,125
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,785
  7. Avatar for uneRx 17. uneRx 1 pt. 7,521
  8. Avatar for Team China 18. Team China 1 pt. 7,288
  1. Avatar for fpc 51. fpc Lv 1 7 pts. 8,683
  2. Avatar for ManVsYard 52. ManVsYard Lv 1 7 pts. 8,676
  3. Avatar for Glen B 53. Glen B Lv 1 6 pts. 8,672
  4. Avatar for frood66 54. frood66 Lv 1 6 pts. 8,672
  5. Avatar for Arne Heessels 55. Arne Heessels Lv 1 5 pts. 8,663
  6. Avatar for abiogenesis 56. abiogenesis Lv 1 5 pts. 8,655
  7. Avatar for detectorist 57. detectorist Lv 1 5 pts. 8,649
  8. Avatar for donuts554 58. donuts554 Lv 1 4 pts. 8,640
  9. Avatar for haabermaaster 59. haabermaaster Lv 1 4 pts. 8,635
  10. Avatar for kathy65 60. kathy65 Lv 1 4 pts. 8,622

Comments