Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 8,635
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,565
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,417
  4. Avatar for :) 14. :) 1 pt. 8,282
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,125
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,785
  7. Avatar for uneRx 17. uneRx 1 pt. 7,521
  8. Avatar for Team China 18. Team China 1 pt. 7,288
  1. Avatar for heather-1 61. heather-1 Lv 1 3 pts. 8,615
  2. Avatar for jausmh 62. jausmh Lv 1 3 pts. 8,572
  3. Avatar for Idiotboy 63. Idiotboy Lv 1 3 pts. 8,570
  4. Avatar for nathanmills 64. nathanmills Lv 1 3 pts. 8,565
  5. Avatar for harvardman 65. harvardman Lv 1 3 pts. 8,562
  6. Avatar for MrZanav 66. MrZanav Lv 1 2 pts. 8,551
  7. Avatar for CAN1958 67. CAN1958 Lv 1 2 pts. 8,513
  8. Avatar for rabamino12358 68. rabamino12358 Lv 1 2 pts. 8,492
  9. Avatar for Alistair69 69. Alistair69 Lv 1 2 pts. 8,484
  10. Avatar for JasperD 70. JasperD Lv 1 2 pts. 8,458

Comments