Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 8,635
  2. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,417
  3. Avatar for :) 14. :) 1 pt. 8,282
  4. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,125
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,785
  6. Avatar for uneRx 17. uneRx 1 pt. 7,521
  7. Avatar for Team China 18. Team China 1 pt. 7,288

  1. Avatar for rinze 71. rinze Lv 1 2 pts. 8,433
  2. Avatar for NewZealand 72. NewZealand Lv 1 2 pts. 8,417
  3. Avatar for jamiexq 73. jamiexq Lv 1 1 pt. 8,410
  4. Avatar for Simek 74. Simek Lv 1 1 pt. 8,409
  5. Avatar for boondog 75. boondog Lv 1 1 pt. 8,391
  6. Avatar for pfirth 76. pfirth Lv 1 1 pt. 8,380
  7. Avatar for IHGreenman 77. IHGreenman Lv 1 1 pt. 8,356
  8. Avatar for cobaltteal 78. cobaltteal Lv 1 1 pt. 8,352
  9. Avatar for zalbitr 79. zalbitr Lv 1 1 pt. 8,340
  10. Avatar for gurch 80. gurch Lv 1 1 pt. 8,332

Comments