Placeholder image of a protein
Icon representing a puzzle

1783: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
January 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Go Science 100 pts. 9,096
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,045
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,034
  4. Avatar for HMT heritage 4. HMT heritage 38 pts. 9,021
  5. Avatar for Contenders 5. Contenders 27 pts. 9,002
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,000
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 8,977
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,945
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 8,873
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 8,858

  1. Avatar for mirp
    1. mirp Lv 1
    100 pts. 9,096
  2. Avatar for silent gene 2. silent gene Lv 1 76 pts. 9,094
  3. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 41 pts. 9,094
  4. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 29 pts. 9,076
  5. Avatar for NinjaGreg 6. NinjaGreg Lv 1 20 pts. 9,075
  6. Avatar for Galaxie 7. Galaxie Lv 1 14 pts. 9,045
  7. Avatar for LociOiling 8. LociOiling Lv 1 9 pts. 9,034
  8. Avatar for robgee 9. robgee Lv 1 6 pts. 9,026
  9. Avatar for alcor29 10. alcor29 Lv 1 4 pts. 9,025

Comments