Placeholder image of a protein
Icon representing a puzzle

1795: Revisiting Puzzle 91: Virus Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
February 05, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,894
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 2 pts. 9,726
  3. Avatar for Russian team 13. Russian team 1 pt. 9,534
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,381
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 9,122
  6. Avatar for Proteomics_2020 16. Proteomics_2020 1 pt. 8,928
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,904
  8. Avatar for Deleted group 18. Deleted group pts. 8,581
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,355
  10. Avatar for BIOF215 20. BIOF215 1 pt. 7,974

  1. Avatar for toshiue
    1. toshiue Lv 1
    100 pts. 10,501
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 83 pts. 10,500
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 68 pts. 10,498
  4. Avatar for silent gene 4. silent gene Lv 1 55 pts. 10,496
  5. Avatar for mirp 5. mirp Lv 1 44 pts. 10,496
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 35 pts. 10,495
  7. Avatar for Galaxie 7. Galaxie Lv 1 27 pts. 10,489
  8. Avatar for Dhalion 8. Dhalion Lv 1 21 pts. 10,479
  9. Avatar for Phyx 9. Phyx Lv 1 16 pts. 10,464
  10. Avatar for robgee 10. robgee Lv 1 12 pts. 10,450

Comments