Placeholder image of a protein
Icon representing a puzzle

1795: Revisiting Puzzle 91: Virus Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
February 05, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,894
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 2 pts. 9,726
  3. Avatar for Russian team 13. Russian team 1 pt. 9,534
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,381
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 9,122
  6. Avatar for Proteomics_2020 16. Proteomics_2020 1 pt. 8,928
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,904
  8. Avatar for Deleted group 18. Deleted group pts. 8,581
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,355
  10. Avatar for BIOF215 20. BIOF215 1 pt. 7,974

  1. Avatar for 8055kenobi 111. 8055kenobi Lv 1 1 pt. 8,638
  2. Avatar for Old Chap 112. Old Chap Lv 1 1 pt. 8,638
  3. Avatar for saber030 113. saber030 Lv 1 1 pt. 8,633
  4. Avatar for xbp 114. xbp Lv 1 1 pt. 8,604
  5. Avatar for Tygh 115. Tygh Lv 1 1 pt. 8,581
  6. Avatar for joshmiller 116. joshmiller Lv 1 1 pt. 8,580
  7. Avatar for Willyanto 117. Willyanto Lv 1 1 pt. 8,542
  8. Avatar for zorojuro 118. zorojuro Lv 1 1 pt. 8,510
  9. Avatar for goggles2905 119. goggles2905 Lv 1 1 pt. 8,508
  10. Avatar for Marvelz 120. Marvelz Lv 1 1 pt. 8,500

Comments