Placeholder image of a protein
Icon representing a puzzle

1795: Revisiting Puzzle 91: Virus Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
February 05, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,894
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 2 pts. 9,726
  3. Avatar for Russian team 13. Russian team 1 pt. 9,534
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,381
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 9,122
  6. Avatar for Proteomics_2020 16. Proteomics_2020 1 pt. 8,928
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,904
  8. Avatar for Deleted group 18. Deleted group pts. 8,581
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,355
  10. Avatar for BIOF215 20. BIOF215 1 pt. 7,974
  1. Avatar for pfirth 81. pfirth Lv 1 4 pts. 9,108
  2. Avatar for rinze 82. rinze Lv 1 4 pts. 9,092
  3. Avatar for Arne Heessels 83. Arne Heessels Lv 1 3 pts. 9,064
  4. Avatar for fpc 84. fpc Lv 1 3 pts. 9,059
  5. Avatar for JasperD 85. JasperD Lv 1 3 pts. 9,030
  6. Avatar for WolverineX 86. WolverineX Lv 1 3 pts. 8,995
  7. Avatar for detectorist 87. detectorist Lv 1 3 pts. 8,993
  8. Avatar for WilliamII 88. WilliamII Lv 1 3 pts. 8,953
  9. Avatar for Rufitarou 89. Rufitarou Lv 1 2 pts. 8,928
  10. Avatar for orily1337 90. orily1337 Lv 1 2 pts. 8,922

Comments