Placeholder image of a protein
Icon representing a puzzle

1795: Revisiting Puzzle 91: Virus Protein

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 05, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Go Science 100 pts. 10,501
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 10,489
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,394
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 10,363
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,245
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,244
  7. Avatar for Contenders 7. Contenders 15 pts. 10,157
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 10,098
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,079
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 10,078

  1. Avatar for pfirth 81. pfirth Lv 1 4 pts. 9,108
  2. Avatar for rinze 82. rinze Lv 1 4 pts. 9,092
  3. Avatar for Arne Heessels 83. Arne Heessels Lv 1 3 pts. 9,064
  4. Avatar for fpc 84. fpc Lv 1 3 pts. 9,059
  5. Avatar for JasperD 85. JasperD Lv 1 3 pts. 9,030
  6. Avatar for WolverineX 86. WolverineX Lv 1 3 pts. 8,995
  7. Avatar for detectorist 87. detectorist Lv 1 3 pts. 8,993
  8. Avatar for WilliamII 88. WilliamII Lv 1 3 pts. 8,953
  9. Avatar for Rufitarou 89. Rufitarou Lv 1 2 pts. 8,928
  10. Avatar for orily1337 90. orily1337 Lv 1 2 pts. 8,922

Comments