Placeholder image of a protein
Icon representing a puzzle

1795: Revisiting Puzzle 91: Virus Protein

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
February 05, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Go Science 100 pts. 10,501
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 10,489
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,394
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 10,363
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,245
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,244
  7. Avatar for Contenders 7. Contenders 15 pts. 10,157
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 10,098
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,079
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 10,078

  1. Avatar for O Seki To 31. O Seki To Lv 1 36 pts. 10,098
  2. Avatar for joremen 32. joremen Lv 1 35 pts. 10,093
  3. Avatar for phi16 33. phi16 Lv 1 34 pts. 10,090
  4. Avatar for pvc78 34. pvc78 Lv 1 33 pts. 10,088
  5. Avatar for Timo van der Laan 35. Timo van der Laan Lv 1 31 pts. 10,079
  6. Avatar for haabermaaster 36. haabermaaster Lv 1 30 pts. 10,078
  7. Avatar for MicElephant 37. MicElephant Lv 1 29 pts. 10,076
  8. Avatar for jausmh 38. jausmh Lv 1 28 pts. 10,076
  9. Avatar for aznarog 39. aznarog Lv 1 27 pts. 10,073
  10. Avatar for RockOn 40. RockOn Lv 1 26 pts. 10,054

Comments