Placeholder image of a protein
Icon representing a puzzle

1797: CRISPR-Cas Transposase Part II: Electron Density

Closed since about 6 years ago

Advanced Overall Prediction Electron Density

Summary


Created
February 07, 2020
Expires
Max points
100
Description

Fold the transposase protein into a density map! This is a followup to Puzzle 1787: CRISPR-Cas Transposase Part II, now with a cryo-EM density map! Players may load in previous work from Puzzle 1787.



CRISPR-Cas is a mixed complex of RNA and proteins, which work together to make a very precise cut in a cell's DNA. Scientists recently discovered a variant of CRISPR-Cas that coopts a new protein called a transposase. In addition to cutting DNA, the transposase also allows precise insertion of new material into a target DNA strand. This new variant could lead to more efficient gene editing with CRISPR-Cas! New cryoEM experiments have shed some light on the transposase structure, which was previously unknown.



We're asking Foldit players to help solve how this transposase protein folds! The transposase is a large 400-residue protein, so this puzzle only includes residues from the second half of the protein. Likewise, the provided density corresponds to only this half of the transposase protein.



Sequence:

GHEAACTVSNWLAGHESKPLPNLPKSYRWGLVHWWMGIKDSEFDHFSFVQFFSNWPRSFHSIIEDEVEFNLEHAVVSTSELRLKDLLGRLFFGSIRLPERNLQHNIILGELLCYLENRLWQDKGLIANLKMNALEATVMLNCSLDQIASMVEQRILKPNRKSKPNSPLDVTDYLFHFGDIFCLWLAEFQSDEFNRSFYVSRW

Top groups


  1. Avatar for Go Science 100 pts. 21,744
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 20,047
  3. Avatar for Hold My Beer 3. Hold My Beer 58 pts. 18,312
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 18,221
  5. Avatar for Contenders 5. Contenders 31 pts. 18,177
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 18,049
  7. Avatar for Marvin's bunch 7. Marvin's bunch 15 pts. 17,990
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 17,968
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 17,925
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 16,494

  1. Avatar for donuts554 81. donuts554 Lv 1 1 pt. 12,448
  2. Avatar for edpalas 82. edpalas Lv 1 1 pt. 11,914
  3. Avatar for MrMegalomania 83. MrMegalomania Lv 1 1 pt. 11,899
  4. Avatar for Willyanto 84. Willyanto Lv 1 1 pt. 11,789
  5. Avatar for Mike Cassidy 85. Mike Cassidy Lv 1 1 pt. 11,296
  6. Avatar for kevin everington 86. kevin everington Lv 1 1 pt. 10,294
  7. Avatar for manu8170 87. manu8170 Lv 1 1 pt. 9,951
  8. Avatar for WilliamII 88. WilliamII Lv 1 1 pt. 9,760
  9. Avatar for kmfkim 89. kmfkim Lv 1 1 pt. 9,426
  10. Avatar for vuvuvu 90. vuvuvu Lv 1 1 pt. 9,371

Comments


Susume Lv 1

The density on this one is in strange flat layers, like it's been skewed somehow. The parts that do look kinda helixy also look like they have been squashed diagonally.

Bautho Lv 1

That's a problem with cryo-EM. It looks like the transposase is very flexible in the overall map of the CRISPR complex. In the corresponding paper, they write, that they have improved the density by masked refinement, but did not publish the map…

bkoep Staff Lv 1

The density here is only half of the transposase density, corresponding to this half of the transposase sequence.

(Puzzle 1794 included the other half of the density, with the other half of the sequence.)

jeff101 Lv 1

If you make sequels to the puzzle series 1784/1794 or 1787/1797,
please let solutions from all previous puzzles in each series
work in their sequels too. If you give us different ED Clouds,
please keep the same coordinates so that if we positioned protein
parts correctly in the previous puzzles, we won't have to adjust
them in the sequels. Please also copy all ED dots from 1794 and
1797 solutions into these puzzles' sequels so that we won't have
to lay out all these ED dots again.

Thanks!
Jeff

bkoep Staff Lv 1

We'll be sure to allow sharing in sequel puzzles so that you can continue with your previous work! I'm not sure if the ED dots can be transferred from puzzle to puzzle…