Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,003
  2. Avatar for Deleted group 12. Deleted group pts. 8,647
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,309
  4. Avatar for OSSM FoldIt Team 14. OSSM FoldIt Team 1 pt. 7,307
  5. Avatar for Bio215_20 15. Bio215_20 1 pt. 7,105
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 6,587
  7. Avatar for Window Group 17. Window Group 1 pt. 5,343

  1. Avatar for crpainter
    1. crpainter Lv 1
    100 pts. 10,101
  2. Avatar for ZeroLeak7 2. ZeroLeak7 Lv 1 97 pts. 9,946
  3. Avatar for grogar7 3. grogar7 Lv 1 94 pts. 9,942
  4. Avatar for silent gene 4. silent gene Lv 1 91 pts. 9,872
  5. Avatar for robgee 5. robgee Lv 1 88 pts. 9,852
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 85 pts. 9,848
  7. Avatar for LociOiling 7. LociOiling Lv 1 82 pts. 9,847
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 79 pts. 9,845
  9. Avatar for Phyx 9. Phyx Lv 1 77 pts. 9,837
  10. Avatar for Serca 10. Serca Lv 1 74 pts. 9,821

Comments