Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,003
  2. Avatar for Deleted group 12. Deleted group pts. 8,647
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,309
  4. Avatar for OSSM FoldIt Team 14. OSSM FoldIt Team 1 pt. 7,307
  5. Avatar for Bio215_20 15. Bio215_20 1 pt. 7,105
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 6,587
  7. Avatar for Window Group 17. Window Group 1 pt. 5,343
  8. Avatar for EnzymeTechnologyBNN30503 18. EnzymeTechnologyBNN30503 1 pt. 668
  1. Avatar for rollingtundarh 131. rollingtundarh Lv 1 1 pt. 6,666
  2. Avatar for Jakkarin 132. Jakkarin Lv 1 1 pt. 6,664
  3. Avatar for yangyixin 133. yangyixin Lv 1 1 pt. 6,663
  4. Avatar for kerpowah 134. kerpowah Lv 1 1 pt. 6,646
  5. Avatar for pdboese 135. pdboese Lv 1 1 pt. 6,622
  6. Avatar for beivazi 136. beivazi Lv 1 1 pt. 6,596
  7. Avatar for NewZealand 137. NewZealand Lv 1 1 pt. 6,587
  8. Avatar for Psych0Active 138. Psych0Active Lv 1 1 pt. 6,516
  9. Avatar for bobbywalsh707 139. bobbywalsh707 Lv 1 1 pt. 6,318
  10. Avatar for improking 140. improking Lv 1 1 pt. 6,265

Comments