Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,003
  2. Avatar for Deleted group 12. Deleted group pts. 8,647
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,309
  4. Avatar for OSSM FoldIt Team 14. OSSM FoldIt Team 1 pt. 7,307
  5. Avatar for Bio215_20 15. Bio215_20 1 pt. 7,105
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 6,587
  7. Avatar for Window Group 17. Window Group 1 pt. 5,343

  1. Avatar for mirp 11. mirp Lv 1 71 pts. 9,777
  2. Avatar for christioanchauvin 12. christioanchauvin Lv 1 69 pts. 9,775
  3. Avatar for tyler0911 13. tyler0911 Lv 1 66 pts. 9,770
  4. Avatar for Deleted player 14. Deleted player 64 pts. 9,768
  5. Avatar for Aubade01 15. Aubade01 Lv 1 62 pts. 9,764
  6. Avatar for Deleted player 16. Deleted player pts. 9,741
  7. Avatar for joremen 17. joremen Lv 1 57 pts. 9,734
  8. Avatar for jobo0502 18. jobo0502 Lv 1 55 pts. 9,732
  9. Avatar for Galaxie 19. Galaxie Lv 1 53 pts. 9,728
  10. Avatar for O Seki To 20. O Seki To Lv 1 51 pts. 9,716

Comments