Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,003
  2. Avatar for Deleted group 12. Deleted group pts. 8,647
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,309
  4. Avatar for OSSM FoldIt Team 14. OSSM FoldIt Team 1 pt. 7,307
  5. Avatar for Bio215_20 15. Bio215_20 1 pt. 7,105
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 6,587
  7. Avatar for Window Group 17. Window Group 1 pt. 5,343

  1. Avatar for fpc 41. fpc Lv 1 22 pts. 9,453
  2. Avatar for Vinara 42. Vinara Lv 1 21 pts. 9,428
  3. Avatar for haabermaaster 43. haabermaaster Lv 1 20 pts. 9,428
  4. Avatar for georg137 44. georg137 Lv 1 19 pts. 9,404
  5. Avatar for Deet 45. Deet Lv 1 18 pts. 9,403
  6. Avatar for heather-1 46. heather-1 Lv 1 17 pts. 9,369
  7. Avatar for aznarog 47. aznarog Lv 1 17 pts. 9,364
  8. Avatar for edpalas 48. edpalas Lv 1 16 pts. 9,296
  9. Avatar for Blipperman 49. Blipperman Lv 1 15 pts. 9,279
  10. Avatar for manu8170 50. manu8170 Lv 1 14 pts. 9,276

Comments