Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,003
  2. Avatar for Deleted group 12. Deleted group pts. 8,647
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,309
  4. Avatar for OSSM FoldIt Team 14. OSSM FoldIt Team 1 pt. 7,307
  5. Avatar for Bio215_20 15. Bio215_20 1 pt. 7,105
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 6,587
  7. Avatar for Window Group 17. Window Group 1 pt. 5,343
  8. Avatar for EnzymeTechnologyBNN30503 18. EnzymeTechnologyBNN30503 1 pt. 668
  1. Avatar for alcor29 51. alcor29 Lv 1 14 pts. 9,266
  2. Avatar for alwen 52. alwen Lv 1 13 pts. 9,239
  3. Avatar for johngran 53. johngran Lv 1 12 pts. 9,221
  4. Avatar for CAN1958 54. CAN1958 Lv 1 12 pts. 9,211
  5. Avatar for Glen B 55. Glen B Lv 1 11 pts. 9,208
  6. Avatar for altejoh 56. altejoh Lv 1 11 pts. 9,202
  7. Avatar for stomjoh 57. stomjoh Lv 1 10 pts. 9,178
  8. Avatar for diamonddays 58. diamonddays Lv 1 10 pts. 9,062
  9. Avatar for Dhalion 59. Dhalion Lv 1 9 pts. 9,048
  10. Avatar for RockOn 60. RockOn Lv 1 9 pts. 9,031

Comments