Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,003
  2. Avatar for Deleted group 12. Deleted group pts. 8,647
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,309
  4. Avatar for OSSM FoldIt Team 14. OSSM FoldIt Team 1 pt. 7,307
  5. Avatar for Bio215_20 15. Bio215_20 1 pt. 7,105
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 6,587
  7. Avatar for Window Group 17. Window Group 1 pt. 5,343
  8. Avatar for EnzymeTechnologyBNN30503 18. EnzymeTechnologyBNN30503 1 pt. 668
  1. Avatar for abiogenesis 61. abiogenesis Lv 1 8 pts. 9,015
  2. Avatar for wosser1 62. wosser1 Lv 1 8 pts. 9,013
  3. Avatar for kitek314_pl 63. kitek314_pl Lv 1 7 pts. 9,003
  4. Avatar for Amphimixus 64. Amphimixus Lv 1 7 pts. 8,993
  5. Avatar for crowns 65. crowns Lv 1 7 pts. 8,937
  6. Avatar for Greg60 66. Greg60 Lv 1 6 pts. 8,915
  7. Avatar for cbwest 67. cbwest Lv 1 6 pts. 8,914
  8. Avatar for ManVsYard 68. ManVsYard Lv 1 6 pts. 8,847
  9. Avatar for rezaefar 69. rezaefar Lv 1 5 pts. 8,813
  10. Avatar for Pawel Tluscik 70. Pawel Tluscik Lv 1 5 pts. 8,808

Comments