Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,003
  2. Avatar for Deleted group 12. Deleted group pts. 8,647
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,309
  4. Avatar for OSSM FoldIt Team 14. OSSM FoldIt Team 1 pt. 7,307
  5. Avatar for Bio215_20 15. Bio215_20 1 pt. 7,105
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 6,587
  7. Avatar for Window Group 17. Window Group 1 pt. 5,343

  1. Avatar for WilliamII 71. WilliamII Lv 1 5 pts. 8,761
  2. Avatar for donuts554 72. donuts554 Lv 1 5 pts. 8,757
  3. Avatar for jausmh 73. jausmh Lv 1 4 pts. 8,752
  4. Avatar for harvardman 74. harvardman Lv 1 4 pts. 8,668
  5. Avatar for Tygh 75. Tygh Lv 1 4 pts. 8,647
  6. Avatar for Siriluk 76. Siriluk Lv 1 4 pts. 8,632
  7. Avatar for JasperD 77. JasperD Lv 1 3 pts. 8,564
  8. Avatar for antibot215 78. antibot215 Lv 1 3 pts. 8,484
  9. Avatar for kathy65 79. kathy65 Lv 1 3 pts. 8,472
  10. Avatar for Axolotlprime 80. Axolotlprime Lv 1 3 pts. 8,459

Comments