Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Contenders 100 pts. 10,101
  2. Avatar for Go Science 2. Go Science 74 pts. 9,946
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 9,942
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,849
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,775
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,771
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 9,716
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,683
  9. Avatar for Gargleblasters 9. Gargleblasters 5 pts. 9,653
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 9,428

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 9,946
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 79 pts. 9,946
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 61 pts. 9,946
  4. Avatar for Dhalion 4. Dhalion Lv 1 47 pts. 9,945
  5. Avatar for mirp 5. mirp Lv 1 35 pts. 9,945
  6. Avatar for silent gene 6. silent gene Lv 1 26 pts. 9,944
  7. Avatar for toshiue 7. toshiue Lv 1 19 pts. 9,944
  8. Avatar for Amphimixus 8. Amphimixus Lv 1 14 pts. 9,910
  9. Avatar for Phyx 9. Phyx Lv 1 10 pts. 9,893

Comments