Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Contenders 100 pts. 10,101
  2. Avatar for Go Science 2. Go Science 74 pts. 9,946
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 9,942
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,849
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,775
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,771
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 9,716
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,683
  9. Avatar for Gargleblasters 9. Gargleblasters 5 pts. 9,653
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 9,428

  1. Avatar for Galaxie 11. Galaxie Lv 1 4 pts. 9,884
  2. Avatar for phi16 12. phi16 Lv 1 3 pts. 9,870
  3. Avatar for alcor29 13. alcor29 Lv 1 2 pts. 9,861
  4. Avatar for robgee 14. robgee Lv 1 1 pt. 9,855
  5. Avatar for Deleted player 15. Deleted player pts. 9,852
  6. Avatar for LociOiling 16. LociOiling Lv 1 1 pt. 9,849
  7. Avatar for Deleted player 17. Deleted player 1 pt. 9,844
  8. Avatar for fpc 18. fpc Lv 1 1 pt. 9,771
  9. Avatar for alwen 19. alwen Lv 1 1 pt. 9,746
  10. Avatar for tamanrasset 20. tamanrasset Lv 1 1 pt. 9,558

Comments