Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Contenders 100 pts. 10,101
  2. Avatar for Go Science 2. Go Science 74 pts. 9,946
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 9,942
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,849
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,775
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,771
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 9,716
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,683
  9. Avatar for Gargleblasters 9. Gargleblasters 5 pts. 9,653
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 9,428

  1. Avatar for mirp 11. mirp Lv 1 71 pts. 9,777
  2. Avatar for christioanchauvin 12. christioanchauvin Lv 1 69 pts. 9,775
  3. Avatar for tyler0911 13. tyler0911 Lv 1 66 pts. 9,770
  4. Avatar for Deleted player 14. Deleted player 64 pts. 9,768
  5. Avatar for Aubade01 15. Aubade01 Lv 1 62 pts. 9,764
  6. Avatar for Deleted player 16. Deleted player pts. 9,741
  7. Avatar for joremen 17. joremen Lv 1 57 pts. 9,734
  8. Avatar for jobo0502 18. jobo0502 Lv 1 55 pts. 9,732
  9. Avatar for Galaxie 19. Galaxie Lv 1 53 pts. 9,728
  10. Avatar for O Seki To 20. O Seki To Lv 1 51 pts. 9,716

Comments