Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,101
  2. Avatar for Go Science 2. Go Science 74 pts. 9,946
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 9,942
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,849
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,775
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,771
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 9,716
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,683
  9. Avatar for Gargleblasters 9. Gargleblasters 5 pts. 9,653
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 9,428
  1. Avatar for PechA 101. PechA Lv 1 1 pt. 8,106
  2. Avatar for Deleted player 102. Deleted player pts. 8,049
  3. Avatar for brockstar113 103. brockstar113 Lv 1 1 pt. 8,041
  4. Avatar for pllq 104. pllq Lv 1 1 pt. 8,035
  5. Avatar for roman madala 105. roman madala Lv 1 1 pt. 8,016
  6. Avatar for Surakiet_Pitikarn 106. Surakiet_Pitikarn Lv 1 1 pt. 8,012
  7. Avatar for cobaltteal 107. cobaltteal Lv 1 1 pt. 7,976
  8. Avatar for smile_seasom 108. smile_seasom Lv 1 1 pt. 7,974
  9. Avatar for Anamfija 109. Anamfija Lv 1 1 pt. 7,945
  10. Avatar for pascal ochem 110. pascal ochem Lv 1 1 pt. 7,899

Comments