Placeholder image of a protein
Icon representing a puzzle

1801: Revisiting Puzzle 93: Spider Toxin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
February 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,101
  2. Avatar for Go Science 2. Go Science 74 pts. 9,946
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 9,942
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,849
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,775
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,771
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 9,716
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,683
  9. Avatar for Gargleblasters 9. Gargleblasters 5 pts. 9,653
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 9,428
  1. Avatar for pvc78 31. pvc78 Lv 1 33 pts. 9,638
  2. Avatar for guineapig 32. guineapig Lv 1 32 pts. 9,623
  3. Avatar for drumpeter18yrs9yrs 33. drumpeter18yrs9yrs Lv 1 31 pts. 9,594
  4. Avatar for johnmitch 34. johnmitch Lv 1 29 pts. 9,581
  5. Avatar for phi16 35. phi16 Lv 1 28 pts. 9,546
  6. Avatar for jamiexq 36. jamiexq Lv 1 27 pts. 9,536
  7. Avatar for Threeoak 37. Threeoak Lv 1 26 pts. 9,525
  8. Avatar for knotartist 38. knotartist Lv 1 25 pts. 9,521
  9. Avatar for bobcat 39. bobcat Lv 1 24 pts. 9,518
  10. Avatar for Idiotboy 40. Idiotboy Lv 1 23 pts. 9,477

Comments