Placeholder image of a protein
Icon representing a puzzle

1804: Revisiting Puzzle 94: Mouse

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,422
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,878
  3. Avatar for Deleted group 13. Deleted group pts. 8,780
  4. Avatar for Brony@Home 15. Brony@Home 1 pt. 8,335
  5. Avatar for Deleted group 16. Deleted group pts. 7,041
  6. Avatar for Window Group 17. Window Group 1 pt. 6,598

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 10,483
  2. Avatar for Timo van der Laan 2. Timo van der Laan Lv 1 97 pts. 10,460
  3. Avatar for Threeoak 3. Threeoak Lv 1 94 pts. 10,430
  4. Avatar for fiendish_ghoul 4. fiendish_ghoul Lv 1 90 pts. 10,389
  5. Avatar for Serca 5. Serca Lv 1 87 pts. 10,380
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 84 pts. 10,379
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 81 pts. 10,376
  8. Avatar for mirp 8. mirp Lv 1 78 pts. 10,355
  9. Avatar for grogar7 9. grogar7 Lv 1 75 pts. 10,345
  10. Avatar for frood66 10. frood66 Lv 1 73 pts. 10,329

Comments


NinjaGreg Lv 1

I download it from the web page, and have to restart when it goes release. Apparently the server records scores whether from prerelease or release.