Placeholder image of a protein
Icon representing a puzzle

1804: Revisiting Puzzle 94: Mouse

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,422
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,878
  3. Avatar for Deleted group 13. Deleted group pts. 8,780
  4. Avatar for Brony@Home 15. Brony@Home 1 pt. 8,335
  5. Avatar for Deleted group 16. Deleted group pts. 7,041
  6. Avatar for Window Group 17. Window Group 1 pt. 6,598

  1. Avatar for nastik 91. nastik Lv 1 1 pt. 8,722
  2. Avatar for pascal ochem 92. pascal ochem Lv 1 1 pt. 8,698
  3. Avatar for EagleGuy 93. EagleGuy Lv 1 1 pt. 8,675
  4. Avatar for hajtogato 94. hajtogato Lv 1 1 pt. 8,637
  5. Avatar for Caraline_nelson 95. Caraline_nelson Lv 1 1 pt. 8,633
  6. Avatar for KindDemon 96. KindDemon Lv 1 1 pt. 8,596
  7. Avatar for Willyanto 97. Willyanto Lv 1 1 pt. 8,564
  8. Avatar for tlaran 98. tlaran Lv 1 1 pt. 8,525
  9. Avatar for Squirrely 99. Squirrely Lv 1 1 pt. 8,513
  10. Avatar for wildone4444 100. wildone4444 Lv 1 1 pt. 8,450

Comments


NinjaGreg Lv 1

I download it from the web page, and have to restart when it goes release. Apparently the server records scores whether from prerelease or release.