Placeholder image of a protein
Icon representing a puzzle

1804: Revisiting Puzzle 94: Mouse

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
February 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,422
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,878
  3. Avatar for Deleted group 13. Deleted group pts. 8,780
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,342
  5. Avatar for Brony@Home 15. Brony@Home 1 pt. 8,335
  6. Avatar for Deleted group 16. Deleted group pts. 7,041
  7. Avatar for Window Group 17. Window Group 1 pt. 6,598
  1. Avatar for Vortrox 101. Vortrox Lv 1 1 pt. 8,438
  2. Avatar for cfcohen77 102. cfcohen77 Lv 1 1 pt. 8,420
  3. Avatar for crsz 103. crsz Lv 1 1 pt. 8,407
  4. Avatar for xythus 104. xythus Lv 1 1 pt. 8,365
  5. Avatar for sktbrd341 105. sktbrd341 Lv 1 1 pt. 8,342
  6. Avatar for neko 106. neko Lv 1 1 pt. 8,335
  7. Avatar for Deleted player 107. Deleted player 1 pt. 8,307
  8. Avatar for KSword Wei 108. KSword Wei Lv 1 1 pt. 8,268
  9. Avatar for fearjuan 109. fearjuan Lv 1 1 pt. 8,261
  10. Avatar for RockOn 110. RockOn Lv 1 1 pt. 8,247

Comments

NinjaGreg Lv 1

I download it from the web page, and have to restart when it goes release. Apparently the server records scores whether from prerelease or release.