Placeholder image of a protein
Icon representing a puzzle

1804: Revisiting Puzzle 94: Mouse

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
February 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,422
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,878
  3. Avatar for Deleted group 13. Deleted group pts. 8,780
  4. Avatar for Brony@Home 15. Brony@Home 1 pt. 8,335
  5. Avatar for Deleted group 16. Deleted group pts. 7,041
  6. Avatar for Window Group 17. Window Group 1 pt. 6,598

  1. Avatar for 157239q 131. 157239q Lv 1 1 pt. 7,344
  2. Avatar for gurch 132. gurch Lv 1 1 pt. 7,291
  3. Avatar for ferkakashi 133. ferkakashi Lv 1 1 pt. 7,241
  4. Avatar for Allem 134. Allem Lv 1 1 pt. 7,176
  5. Avatar for tramtruong1002 135. tramtruong1002 Lv 1 1 pt. 7,041
  6. Avatar for Tehnologik1 136. Tehnologik1 Lv 1 1 pt. 6,974
  7. Avatar for 01010011111 137. 01010011111 Lv 1 1 pt. 6,891
  8. Avatar for gmn 138. gmn Lv 1 1 pt. 6,801
  9. Avatar for jflat06 139. jflat06 Lv 1 1 pt. 6,598
  10. Avatar for Kobiernice 140. Kobiernice Lv 1 1 pt. 6,215

Comments


NinjaGreg Lv 1

I download it from the web page, and have to restart when it goes release. Apparently the server records scores whether from prerelease or release.