Placeholder image of a protein
Icon representing a puzzle

1804: Revisiting Puzzle 94: Mouse

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
February 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,422
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,878
  3. Avatar for Deleted group 13. Deleted group pts. 8,780
  4. Avatar for Brony@Home 15. Brony@Home 1 pt. 8,335
  5. Avatar for Deleted group 16. Deleted group pts. 7,041
  6. Avatar for Window Group 17. Window Group 1 pt. 6,598

  1. Avatar for cbwest 41. cbwest Lv 1 20 pts. 9,858
  2. Avatar for haabermaaster 42. haabermaaster Lv 1 19 pts. 9,851
  3. Avatar for georg137 43. georg137 Lv 1 18 pts. 9,810
  4. Avatar for diamonddays 44. diamonddays Lv 1 17 pts. 9,795
  5. Avatar for Vinara 45. Vinara Lv 1 16 pts. 9,752
  6. Avatar for phi16 46. phi16 Lv 1 16 pts. 9,732
  7. Avatar for heather-1 47. heather-1 Lv 1 15 pts. 9,713
  8. Avatar for jausmh 48. jausmh Lv 1 14 pts. 9,710
  9. Avatar for alcor29 49. alcor29 Lv 1 13 pts. 9,703
  10. Avatar for Crossed Sticks 50. Crossed Sticks Lv 1 13 pts. 9,667

Comments


NinjaGreg Lv 1

I download it from the web page, and have to restart when it goes release. Apparently the server records scores whether from prerelease or release.