Placeholder image of a protein
Icon representing a puzzle

1804: Revisiting Puzzle 94: Mouse

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
February 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,422
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,878
  3. Avatar for Deleted group 13. Deleted group pts. 8,780
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,342
  5. Avatar for Brony@Home 15. Brony@Home 1 pt. 8,335
  6. Avatar for Deleted group 16. Deleted group pts. 7,041
  7. Avatar for Window Group 17. Window Group 1 pt. 6,598
  1. Avatar for kitek314_pl 61. kitek314_pl Lv 1 7 pts. 9,422
  2. Avatar for jamiexq 62. jamiexq Lv 1 7 pts. 9,312
  3. Avatar for Arne Heessels 63. Arne Heessels Lv 1 6 pts. 9,275
  4. Avatar for kathy65 64. kathy65 Lv 1 6 pts. 9,260
  5. Avatar for carsonfb 65. carsonfb Lv 1 6 pts. 9,228
  6. Avatar for Sam256 66. Sam256 Lv 1 5 pts. 9,177
  7. Avatar for Dhalion 67. Dhalion Lv 1 5 pts. 9,163
  8. Avatar for tamanrasset 68. tamanrasset Lv 1 5 pts. 9,161
  9. Avatar for rezaefar 69. rezaefar Lv 1 4 pts. 9,161
  10. Avatar for Pawel Tluscik 70. Pawel Tluscik Lv 1 4 pts. 9,154

Comments

NinjaGreg Lv 1

I download it from the web page, and have to restart when it goes release. Apparently the server records scores whether from prerelease or release.