Placeholder image of a protein
Icon representing a puzzle

1804: Revisiting Puzzle 94: Mouse

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Go Science 100 pts. 10,485
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 10,460
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,430
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 10,413
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 10,389
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,225
  7. Avatar for Contenders 7. Contenders 10 pts. 10,133
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,124
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,872
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,851

  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 70 pts. 10,315
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 68 pts. 10,305
  3. Avatar for Deet 13. Deet Lv 1 65 pts. 10,297
  4. Avatar for Galaxie 14. Galaxie Lv 1 63 pts. 10,272
  5. Avatar for Deleted player 15. Deleted player pts. 10,261
  6. Avatar for LociOiling 16. LociOiling Lv 1 58 pts. 10,228
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 56 pts. 10,225
  8. Avatar for silent gene 18. silent gene Lv 1 54 pts. 10,214
  9. Avatar for Phyx 19. Phyx Lv 1 52 pts. 10,160
  10. Avatar for nicobul 20. nicobul Lv 1 50 pts. 10,154

Comments


NinjaGreg Lv 1

I download it from the web page, and have to restart when it goes release. Apparently the server records scores whether from prerelease or release.