Placeholder image of a protein
Icon representing a puzzle

1804: Revisiting Puzzle 94: Mouse

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Go Science 100 pts. 10,485
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 10,460
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,430
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 10,413
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 10,389
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,225
  7. Avatar for Contenders 7. Contenders 10 pts. 10,133
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,124
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,872
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,851

  1. Avatar for crpainter 21. crpainter Lv 1 48 pts. 10,133
  2. Avatar for Keresto 22. Keresto Lv 1 46 pts. 10,124
  3. Avatar for guineapig 23. guineapig Lv 1 44 pts. 10,112
  4. Avatar for jobo0502 24. jobo0502 Lv 1 42 pts. 10,092
  5. Avatar for robgee 25. robgee Lv 1 40 pts. 10,090
  6. Avatar for aznarog 26. aznarog Lv 1 39 pts. 10,068
  7. Avatar for johnmitch 27. johnmitch Lv 1 37 pts. 10,049
  8. Avatar for Idiotboy 28. Idiotboy Lv 1 36 pts. 10,031
  9. Avatar for stomjoh 29. stomjoh Lv 1 34 pts. 10,016
  10. Avatar for MicElephant 30. MicElephant Lv 1 33 pts. 10,013

Comments


NinjaGreg Lv 1

I download it from the web page, and have to restart when it goes release. Apparently the server records scores whether from prerelease or release.