Placeholder image of a protein
Icon representing a puzzle

1804: Revisiting Puzzle 94: Mouse

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
February 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,485
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 10,460
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,430
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 10,413
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 10,389
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,225
  7. Avatar for Contenders 7. Contenders 10 pts. 10,133
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,124
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,872
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,851
  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 31 pts. 9,993
  2. Avatar for Deleted player 32. Deleted player 30 pts. 9,990
  3. Avatar for Glen B 33. Glen B Lv 1 29 pts. 9,983
  4. Avatar for pvc78 34. pvc78 Lv 1 27 pts. 9,976
  5. Avatar for TastyMunchies 35. TastyMunchies Lv 1 26 pts. 9,972
  6. Avatar for joremen 36. joremen Lv 1 25 pts. 9,961
  7. Avatar for Blipperman 37. Blipperman Lv 1 24 pts. 9,959
  8. Avatar for drumpeter18yrs9yrs 38. drumpeter18yrs9yrs Lv 1 23 pts. 9,940
  9. Avatar for WBarme1234 39. WBarme1234 Lv 1 22 pts. 9,927
  10. Avatar for O Seki To 40. O Seki To Lv 1 21 pts. 9,870

Comments

NinjaGreg Lv 1

I download it from the web page, and have to restart when it goes release. Apparently the server records scores whether from prerelease or release.