Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213
  8. Avatar for ITAS Bocchialini - Parma 18. ITAS Bocchialini - Parma 1 pt. 8,966
  1. Avatar for elwoodblues 91. elwoodblues Lv 1 21 pts. 9,826
  2. Avatar for rinze 92. rinze Lv 1 21 pts. 9,807
  3. Avatar for neko 93. neko Lv 1 20 pts. 9,802
  4. Avatar for J4ckal 94. J4ckal Lv 1 20 pts. 9,785
  5. Avatar for gldisater 95. gldisater Lv 1 20 pts. 9,782
  6. Avatar for g_b 96. g_b Lv 1 19 pts. 9,771
  7. Avatar for oakwhiz 97. oakwhiz Lv 1 19 pts. 9,748
  8. Avatar for KingoRodriguo 98. KingoRodriguo Lv 1 18 pts. 9,742
  9. Avatar for cobaltteal 99. cobaltteal Lv 1 18 pts. 9,739
  10. Avatar for rabamino12358 100. rabamino12358 Lv 1 18 pts. 9,723

Comments